Structure of PDB 1zho Chain C Binding Site BS02

Receptor Information

>1zho Chain C (length=228) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGID
PRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEII
QKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIG
EIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHK
PEGAKGTFLRSVYVTTTMGPSVRINPHS

Ligand information

>1zho Chain D (length=38) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gggagugaaggaggcuucggccgcgaaacuucacuccc

<<<<<<<<<<..<<<....>>>......>>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1zho New insights into the interaction of ribosomal protein L1 with RNA.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	H3 G4 K5 R6 Y7 K36 F37 T40 E42 H44 K46 D166 K167 T168 H172 Y213 T217 M218 G219 P220 S221
Binding residue (residue number reindexed from 1)	H3 G4 K5 R6 Y7 K36 F37 T40 E42 H44 K46 D166 K167 T168 H172 Y213 T217 M218 G219 P220 S221
Binding affinity	PDBbind-CN: Kd=16.5nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0006417	regulation of translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1zho, PDBe:1zho, PDBj:1zho
PDBsum	1zho
PubMed	16330048
UniProt	P27150\|RL1_THETH Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]