Structure of PDB 1ywh Chain C Binding Site BS02

Receptor Information
>1ywh Chain C (length=259) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEK
TNRTLSYRTGLKITSLTEVVCGLDLCNQGNRYLECISCGSSDMSCERGRH
QSLQCRSPEEQCLDVVTHWIQPKDDRHLRGCGYLPGCPGSNGFHNNDTFH
FLKCCNTTKCNEGPILELENLPQNGRQCYSCKGQSTHGCSSEETFLIDCR
GPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCC
TKSGCNHPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ywh Crystal structure of the human urokinase plasminogen activator receptor bound to an antagonist peptide
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R53 T54 L55 Y57 L66 S100 S101 V125 T127 R142 H251 D254 A255
Binding residue
(residue number reindexed from 1)		R53 T54 L55 Y57 L66 S90 S91 V115 T117 R126 H235 D238 A239
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0019904 protein domain specific binding
GO:0030377 urokinase plasminogen activator receptor activity
GO:0038023 signaling receptor activity
Biological Process
GO:0001934 positive regulation of protein phosphorylation
GO:0006935 chemotaxis
GO:0007165 signal transduction
GO:0007596 blood coagulation
GO:0010755 regulation of plasminogen activation
GO:0030155 regulation of cell adhesion
GO:0030162 regulation of proteolysis
GO:0034112 positive regulation of homotypic cell-cell adhesion
GO:0038195 urokinase plasminogen activator signaling pathway
GO:0043066 negative regulation of apoptotic process
GO:0043388 positive regulation of DNA binding
GO:0045742 positive regulation of epidermal growth factor receptor signaling pathway
GO:0051917 regulation of fibrinolysis
GO:0090200 positive regulation of release of cytochrome c from mitochondria
GO:2001243 negative regulation of intrinsic apoptotic signaling pathway
GO:2001268 negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
Cellular Component
GO:0005576 extracellular region
GO:0005788 endoplasmic reticulum lumen
GO:0005789 endoplasmic reticulum membrane
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0016020 membrane
GO:0019898 extrinsic component of membrane
GO:0035579 specific granule membrane
GO:0042995 cell projection
GO:0070161 anchoring junction
GO:0098552 side of membrane
GO:0098637 protein complex involved in cell-matrix adhesion
GO:1905370 serine-type endopeptidase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ywh, PDBe:1ywh, PDBj:1ywh
PDBsum1ywh
PubMed15861141
UniProtQ03405|UPAR_HUMAN Urokinase plasminogen activator surface receptor (Gene Name=PLAUR)

[Back to BioLiP]