Structure of PDB 1yfn Chain C Binding Site BS02

Receptor Information
>1yfn Chain C (length=107) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLN
IAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMF
EPEAAYD
Ligand information
>1yfn Chain G (length=15) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EAQPAPHQWQKMPFW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1yfn Versatile modes of peptide recognition by the AAA+ adaptor protein SspB
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Y45 R47 Q50 V52 L53 N54 A59 A74 R75 F76 Y94 R96
Binding residue
(residue number reindexed from 1)		Y41 R43 Q46 V48 L49 N50 A55 A70 R71 F72 Y90 R92
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1yfn, PDBe:1yfn, PDBj:1yfn
PDBsum1yfn
PubMed15880122
UniProtP0AFZ3|SSPB_ECOLI Stringent starvation protein B (Gene Name=sspB)

[Back to BioLiP]