Structure of PDB 1tw8 Chain C Binding Site BS02

Receptor Information
>1tw8 Chain C (length=257) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFIKPIYQDINSILIGQKVKRPKSGTLSGHAAGEPFEKLVYKFLKENLSD
LTFKQYEYLNDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSI
ENLFEEKQNDTADILLVKDQFYELLDVKTRNISKSAQAPNIISAYKLAQT
CAKMIDNKEFDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYIN
WAAAMQIQFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVK
PFKKYIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tw8 Ca2+ binding in the active site of HincII: implications for the catalytic mechanism
Resolution2.8 Å
Binding residue
(original residue number in PDB)
G30 H31 Q109 N110 D111 D114 K135 A137 Q138 A139 P140 N141 S144 Y146 K147 A205 M206 Q207
Binding residue
(residue number reindexed from 1)
G29 H30 Q108 N109 D110 D113 K134 A136 Q137 A138 P139 N140 S143 Y145 K146 A204 M205 Q206
Binding affinityPDBbind-CN: Kd=1.14nM
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1tw8, PDBe:1tw8, PDBj:1tw8
PDBsum1tw8
PubMed15491133
UniProtP17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)

[Back to BioLiP]