Structure of PDB 1tc3 Chain C Binding Site BS02

Receptor Information
>1tc3 Chain C (length=51) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGT
S
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tc3 Crystal structure of the specific DNA-binding domain of Tc3 transposase of C.elegans in complex with transposon DNA.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		P202 R203 G204 S235 H237 C238 Y249 S252
Binding residue
(residue number reindexed from 1)		P1 R2 G3 S34 H36 C37 Y48 S51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1tc3, PDBe:1tc3, PDBj:1tc3
PDBsum1tc3
PubMed9312061
UniProtP34257|TC3A_CAEEL Transposable element Tc3 transposase (Gene Name=tc3a)

[Back to BioLiP]