Structure of PDB 1rep Chain C Binding Site BS02

Receptor Information

>1rep Chain C (length=214) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSHDGICEIHVAKYAEI
FGLTSAEASKDIRQALKSFAGKEVVFYESFPWFIKPAHSPSRGLYSVHIN
PYLIPFFIGLQNRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSGIVS
LKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKG
RQTTHIVFSFRDIT

Ligand information

>1rep Chain B (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctgagggcaatttgtcacagg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1rep Crystal structure of a prokaryotic replication initiator protein bound to DNA at 2.6 A resolution.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	S75 S79 K80 R83 R124 G125 Y127 Y161 P195 S197 Y198 R200 D203 R207
Binding residue (residue number reindexed from 1)	S55 S59 K60 R63 R92 G93 Y95 Y129 P163 S165 Y166 R168 D171 R175

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003887	DNA-directed DNA polymerase activity

	Biological Process
GO:0006260	DNA replication
GO:0006270	DNA replication initiation
GO:0006276	plasmid maintenance
GO:0071897	DNA biosynthetic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1rep, PDBe:1rep, PDBj:1rep
PDBsum	1rep
PubMed	10469640
UniProt	P03856\|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]