Structure of PDB 1r5w Chain C Binding Site BS02

Receptor Information
>1r5w Chain C (length=180) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFA
SFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEP
NILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLT
FLPSTDDFYDCEVDHWGLEEPLRKHWEFEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r5w Evidence that structural rearrangements and/or flexibility during TCR binding can contribute to T cell activation
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Q9 F51 A52 S53 F54 G58 N62 V65 N69 V72 M73
Binding residue
(residue number reindexed from 1)		Q7 F49 A50 S51 F52 G56 N60 V63 N67 V70 M71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1r5w, PDBe:1r5w, PDBj:1r5w
PDBsum1r5w
PubMed14690592
UniProtP04224|HA22_MOUSE H-2 class II histocompatibility antigen, E-K alpha chain

[Back to BioLiP]