Structure of PDB 1par Chain C Binding Site BS02

Receptor Information
>1par Chain C (length=50) Species: 10754 (Lederbergvirus P22) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1par DNA recognition by beta-sheets in the Arc repressor-operator crystal structure.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		M1 G3 M4 S5 N11 R13 R23 S32 V33 N34
Binding residue
(residue number reindexed from 1)		M1 G3 M4 S5 N11 R13 R23 S32 V33 N34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1par, PDBe:1par, PDBj:1par
PDBsum1par
PubMed8107872
UniProtP03050|RARC_BPP22 Transcriptional repressor arc (Gene Name=arc)

[Back to BioLiP]