Structure of PDB 1p6v Chain C Binding Site BS02

Receptor Information
>1p6v Chain C (length=125) Species: 63363 (Aquifex aeolicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDKIIPIAENKEAKAKYDILETYEAGIVLKGSEVKSLREKGTVSFKDSFV
RIENGEAWLYNLYIAPYKHANHDPLRKRKLLLHKREIMRLYGKVQEKGYT
IIPLKLYWKNNKVKVLIALAKGKKL
Ligand information
>1p6v Chain D (length=24) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucgacggggacuucgguccucgga
....<<<<<<<....>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1p6v Crystal structure of the transfer-RNA domain of transfer-messenger RNA in complex with SmpB
Resolution3.2 Å
Binding residue
(original residue number in PDB)		E26 A27 I29 L31 V36 E58 L86 L87 H88 K89 E91 K117 V118 K119
Binding residue
(residue number reindexed from 1)		E24 A25 I27 L29 V34 E56 L81 L82 H83 K84 E86 K112 V113 K114
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0070929 trans-translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1p6v, PDBe:1p6v, PDBj:1p6v
PDBsum1p6v
PubMed12904796
UniProtO66640|SSRP_AQUAE SsrA-binding protein (Gene Name=smpB)

[Back to BioLiP]