Structure of PDB 1p4e Chain C Binding Site BS02

Receptor Information

>1p4e Chain C (length=400) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SQFDILCKTPPKVLVRQFVERFERPSGEKIASCAAELTYLCWMITHNGTA
IKRATFMSYNTIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWE
FTIIPYNSDITDIVSSLQLQFESNSHSKKMLKALLSEGESIWEITEKILN
SFEYTSRFTKTKTLYQFLFLATFINCGRFSDIKNVDPKSFKLVQNKYLGV
IIQCLVTETKTSVSRHIYFFSARGRIDPLVYLDEFLRNSEPVLKRVNRTG
NKQEYQLLKDNLVRSYNKALKKNAPYPIFAIKNGPKSHIGRHLMTSFLSM
KGLTELTNVVGNFSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPI
SKEMIALKDETNPIEEWQHIEQEGSIRYPAWNGIISQEVLDYLSSYINRR

Ligand information

>1p4e Chain F (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

taagttcctattc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1p4e The role of the conserved Trp330 in Flp-mediated recombination. Functional and structural analysis
Resolution	2.7 Å
Binding residue (original residue number in PDB)	T342 Y343
Binding residue (residue number reindexed from 1)	T325 Y326

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003690	double-stranded DNA binding
GO:0003697	single-stranded DNA binding
GO:0008301	DNA binding, bending
GO:0009009	site-specific recombinase activity

	Biological Process
GO:0006310	DNA recombination
GO:0015074	DNA integration
GO:0042150	plasmid recombination

	Cellular Component
GO:0005575	cellular_component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1p4e, PDBe:1p4e, PDBj:1p4e
PDBsum	1p4e
PubMed	12716882
UniProt	P03870\|FLP_YEAST Site-specific recombinase Flp (Gene Name=FLP1)

[Back to BioLiP]