Structure of PDB 1oct Chain C Binding Site BS02

Receptor Information
>1oct Chain C (length=131) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALN
LSFKNMCKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEE
ITMIADQLNMEKEVIRVWFCNRRQKEKRINP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1oct Crystal structure of the Oct-1 POU domain bound to an octamer site: DNA recognition with tethered DNA-binding modules.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		S43 T46 R49 S56 N59 K62 R102 R105 K125 S128 R146 R153
Binding residue
(residue number reindexed from 1)		S39 T42 R45 S52 N55 K58 R72 R75 K95 S98 R116 R123
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1oct, PDBe:1oct, PDBj:1oct
PDBsum1oct
PubMed8156594
UniProtP14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]