Structure of PDB 1nh2 Chain C Binding Site BS02

Receptor Information
>1nh2 Chain C (length=50) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DYLIENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nh2 Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R253 K255
Binding residue
(residue number reindexed from 1)		R17 K19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006367 transcription initiation at RNA polymerase II promoter
Cellular Component
GO:0005672 transcription factor TFIIA complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1nh2, PDBe:1nh2, PDBj:1nh2
PDBsum1nh2
PubMed12972251
UniProtP32773|TOA1_YEAST Transcription initiation factor IIA large subunit (Gene Name=TOA1)

[Back to BioLiP]