Structure of PDB 1mse Chain C Binding Site BS02

Receptor Information
>1mse Chain C (length=105) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHL
NPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNST
MRRKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mse Solution structure of a specific DNA complex of the Myb DNA-binding domain with cooperative recognition helices.
ResolutionN/A
Binding residue
(original residue number in PDB)		K113 R114 W115 S116 K128 R131 E132 N164 R165 W166 A167 K171 K182 N186 R190
Binding residue
(residue number reindexed from 1)		K25 R26 W27 S28 K40 R43 E44 N76 R77 W78 A79 K83 K94 N98 R102
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1mse, PDBe:1mse, PDBj:1mse
PDBsum1mse
PubMed7954830
UniProtP06876|MYB_MOUSE Transcriptional activator Myb (Gene Name=Myb)

[Back to BioLiP]