Structure of PDB 1mey Chain C Binding Site BS02

Receptor Information
>1mey Chain C (length=83) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKPYKCPECGKSFSQSSNLQKHQRTHTGEKPYKCPECGKSFSQSSDLQKH
QRTHTGEKPYKCPECGKSFSRSDHLSRHQRTHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mey A 2.2 A Resolution Crystal Structure of a Designed Zinc Finger Protein Bound to DNA
Resolution2.2 Å
Binding residue
(original residue number in PDB)		S18 Y33 S46 K50 D74
Binding residue
(residue number reindexed from 1)		S17 Y32 S45 K49 D73
External links