Structure of PDB 1mdy Chain C Binding Site BS02

Receptor Information
>1mdy Chain C (length=62) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAI
RYIEGLQALLRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mdy Crystal structure of MyoD bHLH domain-DNA complex: perspectives on DNA recognition and implications for transcriptional activation.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R111 T115 E118 R119 N126 P145 K146
Binding residue
(residue number reindexed from 1)		R7 T11 E14 R15 N22 P41 K42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0007517 muscle organ development

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1mdy, PDBe:1mdy, PDBj:1mdy
PDBsum1mdy
PubMed8181063
UniProtP10085|MYOD1_MOUSE Myoblast determination protein 1 (Gene Name=Myod1)

[Back to BioLiP]