Structure of PDB 1m8v Chain C Binding Site BS02

Receptor Information

>1m8v Chain C (length=71) Species: 29292 (Pyrococcus abyssi)

ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGE
VVKRYGKIVIRGDNVLAISPT

Ligand information

• Ligand ID: U
• InChI: InChI=1S/C9H13N2O9P/c12-5-1-2-11(9(15)10-5)8-7(14)6(13)4(20-8)3-19-21(16,17)18/h1-2,4,6-8,13-14H,3H2,(H,10,12,15)(H2,16,17,18)/t4-,6-,7-,8-/m1/s1
• InChIKey: DJJCXFVJDGTHFX-XVFCMESISA-N
• SMILES:
  ACDLabs 10.04: O=C1NC(=O)N(C=C1)C2OC(C(O)C2O)COP(=O)(O)O
  CACTVS 3.341: O[CH]1[CH](O)[CH](O[CH]1CO[P](O)(O)=O)N2C=CC(=O)NC2=O
  OpenEye OEToolkits 1.5.0: C1=CN(C(=O)NC1=O)[C@H]2[C@@H]([C@@H]([C@H](O2)COP(=O)(O)O)O)O
  OpenEye OEToolkits 1.5.0: C1=CN(C(=O)NC1=O)C2C(C(C(O2)COP(=O)(O)O)O)O
  CACTVS 3.341: O[C@H]1[C@@H](O)[C@@H](O[C@@H]1CO[P](O)(O)=O)N2C=CC(=O)NC2=O
• Formula: C9 H13 N2 O9 P
• Name: URIDINE-5'-MONOPHOSPHATE
• ChEMBL: CHEMBL214393
• DrugBank: DB03685
• ZINC: ZINC000002123545
• PDB chain: 1m8v Chain C Residue 412

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1m8v Crystal Structure of Pyrococcus abyssii Sm core and its Complex with RNA: Common Features of RNA-binding in Archaea and Eukarya
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): H337 N339 R363 G364 D365
• Binding residue (residue number reindexed from 1): H35 N37 R61 G62 D63
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome

Cellular Component

• GO:0120114 Sm-like protein family complex
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1m8v, PDBe:1m8v, PDBj:1m8v
• PDBsum: 1m8v
• PubMed: 12409299
• UniProt: Q9V0Y8|RUXX_PYRAB Putative snRNP Sm-like protein (Gene Name=PYRAB06500)