Structure of PDB 1m1a Chain C Binding Site BS02

Receptor Information
>1m1a Chain C (length=105) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEIL
ELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQS
VLLPK
Ligand information
>1m1a Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m1a Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
Resolution2.65 Å
Binding residue
(original residue number in PDB)		R829 R835 R842 G844 T876 R877
Binding residue
(residue number reindexed from 1)		R16 R22 R29 G31 T63 R64
Binding affinityPDBbind-CN: Kd=0.6uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1m1a, PDBe:1m1a, PDBj:1m1a
PDBsum1m1a
PubMed12559907
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]