Structure of PDB 1ksy Chain C Binding Site BS02

Receptor Information
>1ksy Chain C (length=145) Species: 10571 (Bovine papillomavirus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATVFKLGLFKSLFLCSFHDITRLFKNDKTTNQQWVLAVFGLAEVFFEASF
ELLKKQCSFLQMQKRSHEGGTCAVYLICFNTAKSRETVRNLMANMLNVRE
ECLMLQPPKIRGLSAALFWFKSSLSPATLKHGALPEWIRAQTTLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ksy Crystal structures of two intermediates in the assembly of the papillomavirus replication initiation complex.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		T239 K241 T245 N248
Binding residue
(residue number reindexed from 1)		T81 K83 T87 N90
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1ksy, PDBe:1ksy, PDBj:1ksy
PDBsum1ksy
PubMed11889054
UniProtP03116|VE1_BPV1 Replication protein E1 (Gene Name=E1)

[Back to BioLiP]