Structure of PDB 1jt0 Chain C Binding Site BS02

Receptor Information
>1jt0 Chain C (length=188) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFL
EILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIE
FYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKI
AANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLSKH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jt0 Structural basis for cooperative DNA binding by two dimers of the multidrug-binding protein QacR.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		S34 S35 K36 G37 N38 Y41 H42
Binding residue
(residue number reindexed from 1)		S33 S34 K35 G36 N37 Y40 H41
Binding affinityPDBbind-CN: Kd=49nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1jt0, PDBe:1jt0, PDBj:1jt0
PDBsum1jt0
PubMed11867549
UniProtP0A0N4|QACR_STAAU HTH-type transcriptional regulator QacR (Gene Name=qacR)

[Back to BioLiP]