Structure of PDB 1jkq Chain C Binding Site BS02

Receptor Information

>1jkq Chain C (length=46) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSI

Ligand information

>1jkq Chain B (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atcttataaaaaac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1jkq Testing water-mediated DNA recognition by the Hin recombinase.
Resolution	2.86 Å
Binding residue (original residue number in PDB)	R140 Y177 P181 A182 S183
Binding residue (residue number reindexed from 1)	R1 Y38 P42 A43 S44
Binding affinity	PDBbind-CN: Kd=27.1nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000150	DNA strand exchange activity
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1jkq, PDBe:1jkq, PDBj:1jkq
PDBsum	1jkq
PubMed	11847127
UniProt	P03013\|HIN_SALTY DNA-invertase hin (Gene Name=hin)

[Back to BioLiP]