Structure of PDB 1jko Chain C Binding Site BS02

Receptor Information

>1jko Chain C (length=46) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASS

Ligand information

>1jko Chain B (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atcttaccaaaaac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1jko Testing water-mediated DNA recognition by the Hin recombinase.
Resolution	2.24 Å
Binding residue (original residue number in PDB)	G139 R140 P141 Y177 A182
Binding residue (residue number reindexed from 1)	G1 R2 P3 Y39 A44
Binding affinity	PDBbind-CN: Kd=7.6nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000150	DNA strand exchange activity
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1jko, PDBe:1jko, PDBj:1jko
PDBsum	1jko
PubMed	11847127
UniProt	P03013\|HIN_SALTY DNA-invertase hin (Gene Name=hin)

[Back to BioLiP]