Structure of PDB 1jj8 Chain C Binding Site BS02

Receptor Information

>1jj8 Chain C (length=49) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKK

Ligand information

>1jj8 Chain B (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atcttatcaaaaac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1jj8 Testing water-mediated DNA recognition by the Hin recombinase.
Resolution	2.75 Å
Binding residue (original residue number in PDB)	G139 R140 P141 Y177 P181 A182 S183
Binding residue (residue number reindexed from 1)	G1 R2 P3 Y39 P43 A44 S45

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000150	DNA strand exchange activity
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1jj8, PDBe:1jj8, PDBj:1jj8
PDBsum	1jj8
PubMed	11847127
UniProt	P03013\|HIN_SALTY DNA-invertase hin (Gene Name=hin)

[Back to BioLiP]