Structure of PDB 1iu3 Chain C Binding Site BS02

Receptor Information
>1iu3 Chain C (length=115) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLGSAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGR
TRVYFAADEQTLLKNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHIMQS
MQFPAELIEKVCGTI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1iu3 Structural and biochemical analyses of hemimethylated DNA binding by the SeqA protein.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R21 G50 R51 T52 R53 Y55 G67 N68 N85 R90
Binding residue
(residue number reindexed from 1)		R20 G49 R50 T51 R52 Y54 G66 N67 N84 R89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1iu3, PDBe:1iu3, PDBj:1iu3
PDBsum1iu3
PubMed14704346
UniProtP0AFY8|SEQA_ECOLI Negative modulator of initiation of replication (Gene Name=seqA)

[Back to BioLiP]