Structure of PDB 1io4 Chain C Binding Site BS02

Receptor Information
>1io4 Chain C (length=120) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGN
DENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQV
ATYHRAIKITVDGPREPRRH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1io4 Structural analyses of DNA recognition by the AML1/Runx-1 Runt domain and its allosteric control by CBFbeta.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R139 R142 G143 K167 T169 V170 D171
Binding residue
(residue number reindexed from 1)		R80 R83 G84 K108 T110 V111 D112
Binding affinityPDBbind-CN: Kd=7.56nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005524 ATP binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1io4, PDBe:1io4, PDBj:1io4
PDBsum1io4
PubMed11257229
UniProtQ03347|RUNX1_MOUSE Runt-related transcription factor 1 (Gene Name=Runx1)

[Back to BioLiP]