Structure of PDB 1h89 Chain C Binding Site BS02

Receptor Information
>1h89 Chain C (length=115) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRI
GKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGR
TDNAIKNHWNSTMRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1h89 Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
Resolution2.45 Å
Binding residue
(original residue number in PDB)
K113 R114 W115 K128 R131 N164 W166 A167 K182
Binding residue
(residue number reindexed from 1)
K37 R38 W39 K52 R55 N88 W90 A91 K106
Binding affinityPDBbind-CN: Kd=1.64nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1h89, PDBe:1h89, PDBj:1h89
PDBsum1h89
PubMed11792321
UniProtP06876|MYB_MOUSE Transcriptional activator Myb (Gene Name=Myb)

[Back to BioLiP]