Structure of PDB 1gt0 Chain C Binding Site BS02

Receptor Information
>1gt0 Chain C (length=137) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEA
LNLSFKNMSKLKPLLEKWLNDAENLGLSRRRKKRTSIETNIRVALEKSFL
ENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gt0 Crystal Structure of a POU/Hmg/DNA Ternary Complex Suggests Differential Assembly of Oct4 and Sox2 on Two Enhancers
Resolution2.6 Å
Binding residue
(original residue number in PDB)		S43 T45 T46 S56 N59 R102 R105 S107 S150 Q154
Binding residue
(residue number reindexed from 1)		S41 T43 T44 S54 N57 R81 R84 S86 S129 Q133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1gt0, PDBe:1gt0, PDBj:1gt0
PDBsum1gt0
PubMed12923055
UniProtP14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]