Structure of PDB 1g2f Chain C Binding Site BS02

Receptor Information
>1g2f Chain C (length=89) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQQASL
NAHIRTHTGEKPFACDICGRKFATLHTRTRHTKIHLRQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1g2f Beyond the "recognition code": structures of two Cys2His2 zinc finger/TATA box complexes.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
T120 Q147 L175 H176
Binding residue
(residue number reindexed from 1)
T20 Q47 L75 H76
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1g2f, PDBe:1g2f, PDBj:1g2f
PDBsum1g2f
PubMed11587646
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]