Structure of PDB 1g2d Chain C Binding Site BS02

Receptor Information
>1g2d Chain C (length=89) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQHTGL
NQHIRTHTGEKPFACDICGRKFATLHTRDRHTKIHLRQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1g2d Beyond the "recognition code": structures of two Cys2His2 zinc finger/TATA box complexes.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
T120 H147 T148 L175 H176 R180
Binding residue
(residue number reindexed from 1)
T20 H47 T48 L75 H76 R80
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1g2d, PDBe:1g2d, PDBj:1g2d
PDBsum1g2d
PubMed11587646
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]