Structure of PDB 1f93 Chain C Binding Site BS02

Receptor Information

>1f93 Chain C (length=99) Species: 10116 (Rattus norvegicus)

HRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVAL
QAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

Ligand information

>1f93 Chain H (length=26) Species: 10090 (Mus musculus)

LSQLQTELLAALLESGLSKEALIQAL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1f93 Structural basis of dimerization, coactivator recognition and MODY3 mutations in HNF-1alpha.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): L55 E58
• Binding residue (residue number reindexed from 1): L50 E53

Enzymatic activity

• Catalytic site (original residue number in PDB): E58 H62 H63 H80 E81 D89
• Catalytic site (residue number reindexed from 1): E53 H57 H58 H75 E76 D84
• Enzyme Commision number: 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.

Gene Ontology

Molecular Function

• GO:0003713 transcription coactivator activity
• GO:0004505 phenylalanine 4-monooxygenase activity
• GO:0008124 4-alpha-hydroxytetrahydrobiopterin dehydratase activity
• GO:0016829 lyase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006558 L-phenylalanine metabolic process
• GO:0006729 tetrahydrobiopterin biosynthetic process
• GO:0008150 biological_process
• GO:0019293 tyrosine biosynthetic process, by oxidation of phenylalanine
• GO:0043393 regulation of protein binding
• GO:0045893 positive regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:1f93, PDBe:1f93, PDBj:1f93
• PDBsum: 1f93
• PubMed: 10966642
• UniProt: P61459|PHS_RAT Pterin-4-alpha-carbinolamine dehydratase (Gene Name=Pcbd1)