Structure of PDB 1f5t Chain C Binding Site BS02

Receptor Information
>1f5t Chain C (length=120) Species: 1717 (Corynebacterium diphtheriae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERD
GLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEA
DRWEHVMSDEVERRLVKVLK
Ligand information
>1f5t Chain F (length=43) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttaacatgcaaggctaaggttaggctaaccttagccttgcatg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f5t Methyl groups of thymine bases are important for nucleic acid recognition by DtxR.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
R3027 A3028 R3029 S3042
Binding residue
(residue number reindexed from 1)
R26 A27 R28 S41
Binding affinityPDBbind-CN: Kd=460nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046914 transition metal ion binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1f5t, PDBe:1f5t, PDBj:1f5t
PDBsum1f5t
PubMed10956029
UniProtP0DJL7|DTXR_CORDI Diphtheria toxin repressor (Gene Name=dtxR)

[Back to BioLiP]