Structure of PDB 1e3o Chain C Binding Site BS02

Receptor Information
>1e3o Chain C (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRF
EALNLSFKNMSKLKPLLEKWLNDAEKRTSIETNIRVALEKSFMENQKPTS
EDITLIAEQLNMEKEVIRVWFSNRRQKEKRIN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1e3o Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
Resolution1.9 Å
Binding residue
(original residue number in PDB)		S43 T45 T46 R49 K58 N59 K62 L63 R105 S128 R146 R153 Q154 K157
Binding residue
(residue number reindexed from 1)		S43 T45 T46 R49 K58 N59 K62 L63 R77 S100 R118 R125 Q126 K129
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1e3o, PDBe:1e3o, PDBj:1e3o
PDBsum1e3o
PubMed11583619
UniProtP14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]