Structure of PDB 1dux Chain C Binding Site BS02

Receptor Information
>1dux Chain C (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTN
MNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1dux Structure of the elk-1-DNA complex reveals how DNA-distal residues affect ETS domain recognition of DNA.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		T6 W46 K50 K52 D58 K59 Y66 Y67
Binding residue
(residue number reindexed from 1)		T2 W42 K46 K48 D54 K55 Y62 Y63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1dux, PDBe:1dux, PDBj:1dux
PDBsum1dux
PubMed10742173
UniProtP19419|ELK1_HUMAN ETS domain-containing protein Elk-1 (Gene Name=ELK1)

[Back to BioLiP]