Structure of PDB 1d5y Chain C Binding Site BS02

Receptor Information

>1d5y Chain C (length=288) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QAGIIRDLLIWLEGHLDQPLSLDNVAAKAGYSKWHLQRMFKDVTGHAIGA
YIRARRLSKSAVALRLTARPILDIALQYRFDSQQTFTRAFKKQFAQTPAL
YRRSPEWSAFGIRPPLRLGEFTMPEHKFVTLEDTPLIGVTQSYSCSLEQI
SDFRHEMRYQFWHDFLGNAPTIPPVLYGLNETRPSQDKDDEQEVFYTTAL
AQDQADGYVLTGHPVMLQGGEYVMFTYEGLGTGVQEFILTVYGTCMPMLN
LTRRKGQDIERYYPAEDDRPINLRCELLIPIRRKLAAA

Ligand information

>1d5y Chain P (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

actttgacattcagtgctgtc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1d5y Crystal structure of the Escherichia coli Rob transcription factor in complex with DNA.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	D25 K35 W36 Q39 R40 A49 G51 A52
Binding residue (residue number reindexed from 1)	D23 K33 W34 Q37 R38 A47 G49 A50

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1d5y, PDBe:1d5y, PDBj:1d5y
PDBsum	1d5y
PubMed	10802742
UniProt	P0ACI0\|ROB_ECOLI Right origin-binding protein (Gene Name=rob)

[Back to BioLiP]