Structure of PDB 1bc8 Chain C Binding Site BS02

Receptor Information
>1bc8 Chain C (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKN
KPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bc8 Structures of SAP-1 bound to DNA targets from the E74 and c-fos promoters: insights into DNA sequence discrimination by Ets proteins.
Resolution1.93 Å
Binding residue
(original residue number in PDB)		T6 W45 K49 M54 K58 R61 Y65 Y66 K69
Binding residue
(residue number reindexed from 1)		T6 W45 K49 M54 K58 R61 Y65 Y66 K69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1bc8, PDBe:1bc8, PDBj:1bc8
PDBsum1bc8
PubMed9734357
UniProtP28324|ELK4_HUMAN ETS domain-containing protein Elk-4 (Gene Name=ELK4)

[Back to BioLiP]