Structure of PDB 1apl Chain C Binding Site BS02

Receptor Information
>1apl Chain C (length=59) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV
SNRRRKEKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1apl Crystal structure of a MAT alpha 2 homeodomain-operator complex suggests a general model for homeodomain-DNA interactions.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y131 R132 R135 Y156 R173 K177 R184 R185 K188
Binding residue
(residue number reindexed from 1)		Y1 R2 R5 Y26 R43 K47 R54 R55 K58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1apl, PDBe:1apl, PDBj:1apl
PDBsum1apl
PubMed1682054
UniProtP0CY08|MTAL2_YEAST Mating-type protein ALPHA2 (Gene Name=MATALPHA2)

[Back to BioLiP]