Structure of PDB 8ove Chain By Binding Site BS02

Receptor Information
>8ove Chain By (length=180) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKIKSHDQITFPEDVTVSVKDRIVTVKGKRGTLTKDLRHLQLDFRVNKKL
RTFTAVRWFGNKINNSTINTALSHVRNMITGVTKGFRFKVRFAYAHFPIS
VTVENQLVEIRNFLGEKRVRRQVVADDVKVYRTDELVLEGNDLEQVSREA
AVMHQLCLVKKKDIRKFLDGIYVQTKTNIE
Ligand information
>8ove Chain BF (length=69) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucgaaucgccacuucucuuauccggugggcugcccgcccggcgcccagua
ccuucauuuucacaagauc
.......<<<.............<<<<<<<.>>>>>>>.>>>........
...................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		K4 H6 R22 Q41 R45 T54 R57 W58
Binding residue
(residue number reindexed from 1)		K4 H6 R22 Q41 R45 T54 R57 W58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum8ove
PubMed37985661
UniProtQ38CD0

[Back to BioLiP]