Structure of PDB 4v7j Chain By Binding Site BS02

Receptor Information
>4v7j Chain By (length=94) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLAGMPDCY
KIKLRSSGYRLVYQVIDEKVVVFVISVGKAERSEVYSEAVKRIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v7j The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R56 E82 S84 Y87
Binding residue
(residue number reindexed from 1)		R55 E81 S83 Y86
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0043022 ribosome binding
GO:0097351 toxin sequestering activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006402 mRNA catabolic process
GO:0017148 negative regulation of translation
GO:0034198 cellular response to amino acid starvation
GO:0040008 regulation of growth
GO:0044010 single-species biofilm formation
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic
Cellular Component
GO:0032993 protein-DNA complex
GO:0110001 toxin-antitoxin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7j, PDBe:4v7j, PDBj:4v7j
PDBsum4v7j
PubMed20005802
UniProtP0C077|RELE_ECOLI mRNA interferase toxin RelE (Gene Name=relE)

[Back to BioLiP]