Structure of PDB 8ove Chain Bv Binding Site BS02

Receptor Information
>8ove Chain Bv (length=143) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVSRKSPEYSTVRKSCKPGTIAIILAGRFRGRRAVILKQLPKNGPLVISG
PMKYSGVPIRRIDSRYIIATSTRVDLTGVDTSAITPEIFKRETVSDERAQ
LQNAIDTALIQAIKKDPLGKEMAGYLHSVFTIKPGDAPHRLKW
Ligand information
>8ove Chain BF (length=69) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucgaaucgccacuucucuuauccggugggcugcccgcccggcgcccagua
ccuucauuuucacaagauc
.......<<<.............<<<<<<<.>>>>>>>.>>>........
...................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		A40 R42 R44 P59 M66 Y68 G70 P72 R74 R75 Y80 R105 E106 T142 S144 R147 K169 H176 S177 V178 T180 K182 P183
Binding residue
(residue number reindexed from 1)		A26 R28 R30 P45 M52 Y54 G56 P58 R60 R61 Y66 R91 E92 T93 S95 R98 K120 H127 S128 V129 T131 K133 P134
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0042301 phosphate ion binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0000315 organellar large ribosomal subunit
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum8ove
PubMed37985661
UniProtQ389K1

[Back to BioLiP]