Structure of PDB 8ova Chain Bs Binding Site BS02

Receptor Information
>8ova Chain Bs (length=50) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEPTLEALAKKYNWEKKVCRRCYARLPVRATNCRKKGCGHCSNLRMKKKL
Ligand information
>8ova Chain BG (length=183) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugagauugugaagggaucucgcaggcaucgugagggaaguaugggguag
uacgagaggaacucccaugccgugccucugguuucuggaguuugucgaag
ggcaagugcuccgacgcuaucgcacggugguucucggcugaacgccucua
agccagaaaccagucccaagaccgggugcccgu
<<<<<<<.........>>>>>>>.<<<<<<....<<<<.<<<<<<<<...
............>>>>>>>><<<<<...<<<<....<<<<<<<<<.....
.>>>>..>>>>>...>>>>..>>>>>.<<<<..<.<<<<...........
>>>>.>..>>>>.>>>>.......>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution2.47 Å
Binding residue
(original residue number in PDB)		R102 R111 K112
Binding residue
(residue number reindexed from 1)		R25 R34 K35
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
Biological Process
GO:0006412 translation
GO:0016567 protein ubiquitination
GO:0019941 modification-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum8ova
PubMed37985661
UniProtP21899|RL40_TRYBB Ubiquitin-ribosomal protein eL40 fusion protein

[Back to BioLiP]