Structure of PDB 8ova Chain Bp Binding Site BS02

Receptor Information
>8ova Chain Bp (length=77) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PREIKNLKEFLAICSRKDARCVKVKHNPKVTKFKVRCSRHLYTLVMADKK
KADKIERSIHPSVKKITVTSRSHANKN
Ligand information
>8ova Chain BE (length=188) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuguggaaaugcgaaacacuugccaggugacccauccauccucccacggu
gagcuuucuuuucaccauaauccacuugggccucucgacuucucgcguua
cucggagcgggggcucaagauugaaaaaugcagcucacccuacguacugu
ugugaguucggcgcauuaaagcaaaaaccugggguguu
..<<<....>>>.....<<<..<<<<<<.......<<...<<<<...<<<
<<<.......>>>>>><...<<.<<<<<<<<<<<<........<<.....
..>>....>>>>>>>>>>>.>.>>....><<<<...<<.....>>.>>>>
.>.>>>...>>...............>>>>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution2.47 Å
Binding residue
(original residue number in PDB)		E4 K26 K33 K35 T44 V69 S71 S73 A75
Binding residue
(residue number reindexed from 1)		E3 K25 K32 K34 T43 V68 S70 S72 A74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0022618 protein-RNA complex assembly
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum8ova
PubMed37985661
UniProtQ38FV6

[Back to BioLiP]