Structure of PDB 8q87 Chain Bo Binding Site BS02

Receptor Information
>8q87 Chain Bo (length=105) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNVPKTRRTYCKKCGKHQPHKVTQYKKGKDSLHAQGKRRYTRKQSGYGGQ
TKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKG
QVIQF
Ligand information
>8q87 Chain V (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccgaaauagcucaguugggagagcgggagacugaagauccaaagguccc
ugguucgaucccgggucccggcacca
<<<<..<..<<<<........>>>>....<<.......>>........<<
<<<.......>>>>>>..>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q87 Structural insights into inactive ribosome complexes derived from cold-treated chick embryo cells
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y41 X53 P54 F56
Binding residue
(residue number reindexed from 1)		Y40 X52 P53 F55
External links