Structure of PDB 4v8z Chain Bo Binding Site BS02

Receptor Information
>4v8z Chain Bo (length=105) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFG
GQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKG
QALQF
Ligand information
>4v8z Chain CW (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucagucgguagagcaggggauucauaauccccguguccu
ugguucgauuccgaguccgggcacca
....<<<..<<<<........>>>>.<<<<<<.....>>>>>>.....<<
<<<.......>>>>>>>>........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v8z Molecular architecture of a eukaryotic translational initiation complex.
Resolution6.6 Å
Binding residue
(original residue number in PDB)
L104 Q105 F106
Binding residue
(residue number reindexed from 1)
L103 Q104 F105
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0046677 response to antibiotic
GO:0046898 response to cycloheximide
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v8z, PDBe:4v8z, PDBj:4v8z
PDBsum4v8z
PubMed24200810
UniProtP0CX27|RL44A_YEAST Large ribosomal subunit protein eL42A (Gene Name=RPL42A)

[Back to BioLiP]