Structure of PDB 7zrs Chain Bn Binding Site BS02

Receptor Information
>7zrs Chain Bn (length=103) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFG
GQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKG
QAL
Ligand information
>7zrs Chain 6 (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uccgauauagcguaacggcuaucacaucacgcuuucaccguggagaccgg
gguucgacuccccguaucggagcca
<<<<<<<..<.<..........>.>.<<<<<.......>>>>>....<<<
<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zrs Structural basis for clearing of ribosome collisions by the RQT complex.
Resolution4.8 Å
Binding residue
(original residue number in PDB)		Y43 K55 P56 F58
Binding residue
(residue number reindexed from 1)		Y42 K54 P55 F57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0046677 response to antibiotic
GO:0046898 response to cycloheximide
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zrs, PDBe:7zrs, PDBj:7zrs
PDBsum7zrs
PubMed36801861
UniProtP0CX27|RL44A_YEAST Large ribosomal subunit protein eL42A (Gene Name=RPL42A)

[Back to BioLiP]