Structure of PDB 8apn Chain Bm Binding Site BS02

Receptor Information
>8apn Chain Bm (length=113) Species: 353565 (Polytomella magna) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQIQRVTLPPHQCVYMALKKVFGLGGPTSLAVVEACGISKGVRVRDLKEN
HVQQITQFIQDNFVTEDNLRRKVREDIVKLVNIKSRDGLRHDWGVSIKGH
TSCNGKTAKRLRH
Ligand information
>8apn Chain B4 (length=337) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaaccacgguauugcauggcugauauauaauccauacaaaggauauaacc
aaguagcauggucuuauauugugggcuggcggugugcuacaaguaacaaa
aaguacaaccggauuaauuacugaaaucauaaauauaaagagggaaucgc
uaguaaucuuuauuauaacauaaaggugaaccaguuuagugugcacacac
ugcccgucacauccgggaaaaccacaaagcccuaaguuuguauaguguuu
aauaaaccaauucaaacauaagcuuauuguuaacaaggaugaagucguaa
caagguuugcguaggggaaccugcucaagauuaugcu
.......<<.<<...<<<<<<.....<<<.<<<.......>>>>>>....
.>>>..>>>.>>>>...............................<<...
..>>.....<....<<.<<<.........>>>.>>....>..........
.....<<<<<<<<......>>>>>>>>.......................
.<..<<.<.<<<<<..<..<<<.<..<<<<....<<<<<<.<<.<.<<..
.....>>>.>>.>>>>>.>..>>>>.>.>>>..>..>>>>>..>.>>...
>.....<<<.<<<<<....>>>>>.>>>.........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8apn Structure of a mitochondrial ribosome with fragmented rRNA in complex with membrane-targeting elements.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Q13 M17 K20 F23 G24 L25 G26 P28 T29 H92 W94 I98 K99 G100 H101 S103 T108 K110
Binding residue
(residue number reindexed from 1)		Q12 M16 K19 F22 G23 L24 G25 P27 T28 H91 W93 I97 K98 G99 H100 S102 T107 K109
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Nov 27 18:29:47 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8apn', asym_id = 'Bm', bs = 'BS02', title = 'Structure of a mitochondrial ribosome with fragm...rRNA in complex with membrane-targeting elements.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8apn', asym_id='Bm', bs='BS02', title='Structure of a mitochondrial ribosome with fragm...rRNA in complex with membrane-targeting elements.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676,0003723,0003735,0005840,0006412', uniprot = '', pdbid = '8apn', asym_id = 'Bm'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003723,0003735,0005840,0006412', uniprot='', pdbid='8apn', asym_id='Bm')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>