Structure of PDB 6uz7 Chain Bl Binding Site BS02

Receptor Information
>6uz7 Chain Bl (length=49) Species: 28985 (Kluyveromyces lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMN
Ligand information
>6uz7 Chain 8 (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaauugcgauauguauugugaauugcagauuuucgugaaucaucaaaucu
uugaacgcacauugcgcccucugguauuccagggggcaugccuguuugag
cgucauu
.........................................<<<<<<.<<
.....>>>.....<..<<......>>..............>>...>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uz7 Long-range interdomain communications in eIF5B regulate GTP hydrolysis and translation initiation.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		F7 R8 K12 K15 Q19 R21 L23 P24 W26 I27 L29 T31 K40
Binding residue
(residue number reindexed from 1)		F6 R7 K11 K14 Q18 R20 L22 P23 W25 I26 L28 T30 K39
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 18:05:10 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6uz7', asym_id = 'Bl', bs = 'BS02', title = 'Long-range interdomain communications in eIF5B regulate GTP hydrolysis and translation initiation.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6uz7', asym_id='Bl', bs='BS02', title='Long-range interdomain communications in eIF5B regulate GTP hydrolysis and translation initiation.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6uz7', asym_id = 'Bl'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6uz7', asym_id='Bl')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>