Structure of PDB 8ova Chain Bk Binding Site BS02

Receptor Information
>8ova Chain Bk (length=123) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVKIRDLKEKGKDDLLKQLSEFKKELSQLRVSQQMNVGAARLGRIRTIRK
GIARIMTVLNKNERENLRKFYSDKKLRSAKPKTLRAKLTHRRRLALKANE
KNRKTRRQLRMAHKFPRRIYAVK
Ligand information
>8ova Chain BC (length=160) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagc
aaagugcgauaagugguaucaauugcagaaauugcccaaucuuugaacgc
aaacggcgcaugggagaagcucgagccauccccgugcaugccacauuucu
cagugucgaa
.........................................<<<<<<<<<
....>>>>.....(<<<<......>>......>>>>.)...>>>....<<
.....>><<<<<<<....<<<..>>>....>>>>>>>.............
..........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution2.47 Å
Binding residue
(original residue number in PDB)
I7 K53 R57 M59 N63 R67 K85 K90 T92 H93 R94 R96
Binding residue
(residue number reindexed from 1)
I4 K50 R54 M56 N60 R64 K82 K87 T89 H90 R91 R93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum8ova
PubMed37985661
UniProtQ38FW8

[Back to BioLiP]