Structure of PDB 7o81 Chain Bh Binding Site BS02

Receptor Information

>7o81 Chain Bh (length=122) Species: 9986 (Oryctolagus cuniculus)

AKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVR
KSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEES
LKTKKQQRKERLYPLRKYAVKA

Ligand information

>7o81 Chain B8 (length=156)

cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccggguuccucccggggcuacgccugucugagc
gucgcu

.........................................<<<<<<<<<
....>>>>.....<.<<<......>>.............>>>..>...>>
>....<<....>><<<<<<<<<.....>>>>>>>>>..............
......

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7o81 Structural basis of ribosomal frameshifting during translation of the SARS-CoV-2 RNA genome.
• Resolution: 3.1 Å
• Binding residue (original residue number in PDB): A2 K3 K5 A6 S42 S45 K46 R48 V49 R51 K52 A55 R56 L58 T59 N62 Q63 K66 R70 L81 R84 P85 K86 T88 R89 R92
• Binding residue (residue number reindexed from 1): A1 K2 K4 A5 S41 S44 K45 R47 V48 R50 K51 A54 R55 L57 T58 N61 Q62 K65 R69 L80 R83 P84 K85 T87 R88 R91

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7o81, PDBe:7o81, PDBj:7o81
• PDBsum: 7o81
• PubMed: 34029205
• UniProt: G1SIT5|RL35_RABIT Large ribosomal subunit protein uL29 (Gene Name=RPL35)