Structure of PDB 6uz7 Chain Bh Binding Site BS02

Receptor Information

>6uz7 Chain Bh (length=116) Species: 28985 (Kluyveromyces lactis)

GIKAYELRTKSKDQLEQQLVELKKELAELKVQKLSRPSLPKINTVRKNIA
RVLTVISQNQRQAVRELYKGKKYQPKDLRAKKTRALRRALTKFEASQVTE
KQRKKQIAFPQRKYAI

Ligand information

>6uz7 Chain 8 (length=157)

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaauugcgauauguauugugaauugcagauuuucgugaaucaucaaaucu
uugaacgcacauugcgcccucugguauuccagggggcaugccuguuugag
cgucauu

.........................................<<<<<<.<<
.....>>>.....<..<<......>>..............>>...>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
.......

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6uz7 Long-range interdomain communications in eIF5B regulate GTP hydrolysis and translation initiation.
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): K5 A6 Y7 R10 K35 N45 R48 K49 A52 R53 L55 T56 R63 K78 A82 T85 R86 R89
• Binding residue (residue number reindexed from 1): K3 A4 Y5 R8 K33 N43 R46 K47 A50 R51 L53 T54 R61 K76 A80 T83 R84 R87

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6uz7, PDBe:6uz7, PDBj:6uz7
• PDBsum: 6uz7
• PubMed: 31900355
• UniProt: Q6CL71