Structure of PDB 4v6i Chain Bc Binding Site BS02

Receptor Information
>4v6i Chain Bc (length=118) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSIA
CVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVTE
KQRKKQIAFPQRKYAIKA
Ligand information
>4v6i Chain DB (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagcg
aaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucuu
ugaacgcacauugcgccccuugguauuccagggggcaugccuguuugagc
gucauuu
........................................<<<<<<....
....>>>..............<......>...................>>
>....<<<...>>><<<<<<<<<....>>>>>>>>>..............
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
Resolution8.8 Å
Binding residue
(original residue number in PDB)		K5 A6 L41 R48 K49 A52 T56 E60 R63 P77 L80 R81 T85 R86 A87 L88 R90
Binding residue
(residue number reindexed from 1)		K3 A4 L39 R46 K47 A50 T54 E58 R61 P75 L78 R79 T83 R84 A85 L86 R88
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Feb 20 04:21:34 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4v6i', asym_id = 'Bc', bs = 'BS02', title = 'Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4v6i', asym_id='Bc', bs='BS02', title='Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0000463,0003735,0005840,0006412,0022625', uniprot = '', pdbid = '4v6i', asym_id = 'Bc'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000463,0003735,0005840,0006412,0022625', uniprot='', pdbid='4v6i', asym_id='Bc')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>