Structure of PDB 8ove Chain Ba Binding Site BS02

Receptor Information

>8ove Chain Ba (length=130) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KFLKPGKVVIMTSGRYAGKKAVIVQNTDTRNKERPYGHSLLAGIKKYPRK
VVRGMSKRSITRRSQVGVFLRVVNHKHFLPTRYNMDLSRELRGRINVASK
KAKSKQLVKRLFQARYNAGNNRWFFQRLRF

Ligand information

>8ove Chain BE (length=166) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

guggaaaugcgcuugccaggugacccauccauccucccacggugagcuuu
cuuuucaccauaauccaccuugggccucucgacgcguuacucggagcggg
ggcucaagauugaaaaaugcagcacugucugugaguucggcgcauuaaag
caaaaaccuggggugu

<<<....>>>..<..<<<<<<.......<<...<<<.<<.<<<<<<....
...>>>>>><...<<.<.<<<<<<<<<<<...<<.......>>....>>>
>>>>>>>>.>.>>....><<<<..>>>>.>>.>>>...>>..........
.....>>>>>>.>...

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	G15 R16 R35 Y37 K46 K47 R72 V73 N75 K77 H78 R130
Binding residue (residue number reindexed from 1)	G14 R15 R34 Y36 K45 K46 R71 V72 N74 K76 H77 R127

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum	8ove
PubMed	37985661
UniProt	Q381J6

[Back to BioLiP]